Germany
Japan
United Kingdom
China
MEIS1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MEIS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the middle region of human MEIS1. Synthetic peptide located within the following region: GKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGT |
Rabbit Polyclonal Anti-MEIS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MEIS1 Antibody: synthetic peptide directed towards the C terminal of human MEIS1. Synthetic peptide located within the following region: AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM |
Meis1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
MEIS1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MEIS1. |
Active filters
Target Symbol
- MEIS1
Applications
- WB
Antibody Hosts
- Rabbit