Antibodies

View as table Download

Rabbit Polyclonal Anti-C19orf28 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C19orf28 Antibody: synthetic peptide directed towards the middle region of human C19orf28. Synthetic peptide located within the following region: VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD

Rabbit Polyclonal Anti-C19orf28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C19orf28 Antibody: synthetic peptide directed towards the N terminal of human C19orf28. Synthetic peptide located within the following region: MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV