OR5AN1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 279-310 amino acids from the C-terminal region of human Olfactory receptor 5AN1 |
OR5AN1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 279-310 amino acids from the C-terminal region of human Olfactory receptor 5AN1 |
Rabbit Polyclonal Anti-OR5AN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR5AN1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5AN1. Synthetic peptide located within the following region: LSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKRKC |