Antibodies

Jump to Filters
View as table Download
Rab4 (RAB4A) Rabbit Polyclonal Antibody
TA342684

USD 375.00

In Stock

Rabbit Polyclonal Anti-RAB4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG
Rab4 (RAB4A) Rabbit Polyclonal Antibody
TA380642

USD 220.00

3 Weeks

RAB4A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human RAB4A (NP_004569.2).
Modifications Unmodified