Antibodies

Jump to Filters
View as table Download
RBP1 Rabbit Polyclonal Antibody
TA590146

USD 409.00

In Stock

Rabbit Polyclonal Retinol Binding Protein RBP Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.
RBP1 Rabbit Polyclonal Antibody
TA346334

USD 410.00

5 Days

Rabbit Polyclonal Anti-RBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBP1 antibody: synthetic peptide directed towards the middle region of human RBP1. Synthetic peptide located within the following region: IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
RBP1 Rabbit Polyclonal Antibody
TA359714

USD 360.00

5 Days

RBP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RBP1
RBP1 Rabbit Polyclonal Antibody
TA380797

USD 220.00

3 Weeks

RBP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 63-197 of human RBP1 (NP_002890.2).
Modifications Unmodified