Antibodies

View as table Download

Rabbit Polyclonal Anti-RPS13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS13 Antibody: synthetic peptide directed towards the N terminal of human RPS13. Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Rabbit Polyclonal Anti-RPS13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS13 Antibody: synthetic peptide directed towards the middle region of human RPS13. Synthetic peptide located within the following region: ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES

RPS13 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 79-151 of human RPS13 (NP_001008.1).
Modifications Unmodified