Antibodies

Jump to Filters
View as table Download
SEPSECS Rabbit Polyclonal Antibody
TA344015

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLA antibody: synthetic peptide directed towards the N terminal of human SLA/LP. Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG
SEPSECS Rabbit Polyclonal Antibody
TA381362

USD 220.00

3 Weeks

SEPSECS Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 222-501 of human SEPSECS (NP_058651.3).
Modifications Unmodified