Rabbit Polyclonal Anti-STK19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK19 antibody is: synthetic peptide directed towards the middle region of Human STK19. Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE |
STK19 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human STK19 |
STK19 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 75-364 of human STK19 (NP_004188.1). |
| Modifications | Unmodified |
STK19 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 75-364 of human STK19 (NP_004188.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China