Rabbit Polyclonal Anti-TNFRSF18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Rabbit Polyclonal Anti-TNFRSF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Recombinant Anti-GITR (Clone DTA-1)
| Applications | FC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
