Antibodies

View as table Download

Rabbit Polyclonal Anti-UBE2O Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2O antibody: synthetic peptide directed towards the middle region of human UBE2O. Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

UBE2O Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1073-1292 of human UBE2O (NP_071349.3).
Modifications Unmodified