Rabbit polyclonal anti-UBE3B antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBE3B. |
Rabbit polyclonal anti-UBE3B antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBE3B. |
Rabbit Polyclonal Anti-UBE3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE3B antibody: synthetic peptide directed towards the middle region of human UBE3B. Synthetic peptide located within the following region: VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE |