Antibodies

View as table Download

WFDC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2).

WFDC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 111-220 of human WFDC1 (NP_067020.2).

Rabbit Polyclonal Anti-WFDC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the middle region of human WFDC1. Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Rabbit Polyclonal Anti-WFDC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the N terminal of human WFDC1. Synthetic peptide located within the following region: WKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQ

WFDC1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 147-177 (H163)amino acids from the C-terminal region of human WFDC1