Rabbit Polyclonal Anti-ZMYND11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the middle region of human ZMYND11. Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV |
Rabbit Polyclonal Anti-ZMYND11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the N terminal of human ZMYND11. Synthetic peptide located within the following region: KKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNT |
BS69 (ZMYND11) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ZMYND11 |
ZMYND11 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 278-567 of human ZMYND11 (NP_997644.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
