Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-INPP5K Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTEN Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |