Antibodies

View as table Download

PDE4 (PDE4B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 196-225 amino acids from the Central region of Human PDE4B

Rabbit Polyclonal Anti-PDE4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Rabbit polyclonal antibody to Phosphodiesterase 4B (phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 489 and 736 of PDE4B (Uniprot ID#Q07343)