Rabbit Polyclonal Anti-TPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPR antibody: synthetic peptide directed towards the C terminal of human TPR. Synthetic peptide located within the following region: SSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRR |
Rabbit Polyclonal Anti-TPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPR antibody: synthetic peptide directed towards the C terminal of human TPR. Synthetic peptide located within the following region: SQNSGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPP |
Germany
Japan
United Kingdom
China
