Antibodies

View as table Download

Rabbit Polyclonal Anti-SGCB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCB antibody is: synthetic peptide directed towards the middle region of Human SGCB. Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN

Rabbit Polyclonal Anti-SGCB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCB antibody: synthetic peptide directed towards the middle region of human SGCB. Synthetic peptide located within the following region: FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN