Nociceptin receptor (OPRL1) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Nociceptin receptor (OPRL1) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OPRL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OPRL1 antibody: synthetic peptide directed towards the middle region of human OPRL1. Synthetic peptide located within the following region: ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ |
Anti-OPRL1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 360-380 amino acids of Human opiate receptor-like 1 |
Anti-OPRL1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 360-380 amino acids of Human opiate receptor-like 1 |