USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
WT1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WT1 |
Rabbit Polyclonal Anti-WT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA |
Rabbit polyclonal antibody to WT1 (Wilms tumor 1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 209 and 449 of Wilms Tumor 1 (Uniprot ID#P19544) |
Rabbit Polyclonal anti-WT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-WT1 antibody is: synthetic peptide directed towards the N-terminal region of Human WT1. Synthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC |
Rabbit Polyclonal Anti-WT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WT1 antibody: synthetic peptide directed towards the N terminal of human WT1. Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA |
USD 180.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |