Antibodies

Jump to Filters
View as table Download
OR4C6 Rabbit Polyclonal Antibody
TA316227

USD 345.00

In Stock

Rabbit polyclonal anti-OR4C6 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4C6.
OR4C6 Rabbit Polyclonal Antibody
TA334811

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4C6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR4C6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4C6. Synthetic peptide located within the following region: VILCSLKSYSSKGRHKALSTCSSHLTVVVLFFVPCIFLYMRPVVTHPIDK