Antibodies

View as table Download

Rabbit polyclonal GATA2 (Ser401) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GATA2 around the phosphorylation site of serine 401 (K-M-SP-N-K).
Modifications Phospho-specific

Rabbit Polyclonal anti-GATA2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2. Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA