Antibodies

View as table Download

Rabbit Polyclonal Anti-SOX9 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ

Rabbit Polyclonal SOX9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Feline, Goat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody.

Rabbit anti SOX-9 (pS181) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding the epitope –RKSVK- with a single phosphorylation site Ser181. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.

Rabbit anti SOX-9 (paired S181) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding the epitope –RKSVK- without phosphorylation. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.

Rabbit anti SOX-9 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of Human SOX-9 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog.