Antibodies

View as table Download

Rabbit Polyclonal Anti-PDE4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Rabbit polyclonal antibody to Phosphodiesterase 4B (phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 489 and 736 of PDE4B (Uniprot ID#Q07343)