Rabbit anti-IKBKG Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKG |
Rabbit anti-IKBKG Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKG |
Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R). |
Modifications | Phospho-specific |
Rabbit polyclonal IKK-gamma (Ab-85) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R) |
Rabbit polyclonal anti-OR10G6 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10G6. |
Rabbit polyclonal anti-RFX5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal anti-IKK-gamma antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IKK-?. |
Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P). |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK-gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-gamma |
Rabbit Polyclonal IKK-? Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-? |
Rabbit Polyclonal IKK- gamma (Ser31) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- gamma around the phosphorylation site of Serine 31 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK-? (Ser85) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-? around the phosphorylation site of Serine 85 |
Modifications | Phospho-specific |
Rabbit Polyclonal RFX-AP Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein. |
Rabbit Polyclonal IKK gamma Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKK gamma antibody was raised against a 17 amino acid peptide near the carboxy terminus of human IKK gamma. The immunogen is located within the last 50 amino acids of IKK gamma. |
Rabbit polyclonal IKK-gamma (Ab-31) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP- P-L). |
Rabbit polyclonal IKK-gamma (Ser31) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP-P-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RFXAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RFXAP Antibody: synthetic peptide directed towards the middle region of human RFXAP. Synthetic peptide located within the following region: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLE |
Rabbit Polyclonal Anti-RFX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the N terminal of human RFX5. Synthetic peptide located within the following region: MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGIL |
Rabbit Polyclonal Anti-RFX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the C terminal of human RFX5. Synthetic peptide located within the following region: VIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP |
Rabbit Polyclonal Anti-IKBKG Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKBKG |