DAGLB (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 497~527 amino acids from the Center region of Human DAGLB. |
DAGLB (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 497~527 amino acids from the Center region of Human DAGLB. |
Rabbit Polyclonal Anti-DAGLB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DAGLB Antibody: synthetic peptide directed towards the middle region of human DAGLB. Synthetic peptide located within the following region: STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS |