Rabbit polyclonal anti-SOX12 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SOX12. |
Rabbit polyclonal anti-SOX12 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SOX12. |
Rabbit Polyclonal Anti-SOX12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX12 Antibody: synthetic peptide directed towards the C terminal of human SOX12. Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY |
Rabbit Polyclonal Anti-SOX12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX12 Antibody: synthetic peptide directed towards the C terminal of human SOX12. Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY |