Antibodies

View as table Download

Rabbit anti-ACADM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACADM

ACADM rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM.

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

ACADM Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ACADM

ACADM Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-421 of human ACADM (NP_000007.1).
Modifications Unmodified

ACADM Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ACADM

ACADM Rabbit monoclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated