Antibodies

Jump to Filters
View as table Download
ADAM33 Rabbit Polyclonal Antibody
TA339550

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADAM33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM33 antibody: synthetic peptide directed towards the middle region of human ADAM33. Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
ADAM33 Rabbit Polyclonal Antibody
TA373261

USD 275.00

3 Weeks

ADAM33 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human ADAM33 (NP_001269376.1).
Modifications Unmodified