Antibodies

Jump to Filters
View as table Download
ACCN2 (ASIC1) (C-term) Rabbit Polyclonal Antibody
AP50044PU-N

USD 450.00

2 Weeks

ACCN2 (ASIC1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 499~528 amino acids from the C-terminal region of human ACCN2
ACCN2 (ASIC1) Rabbit Polyclonal Antibody
TA338589

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACCN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN2 antibody: synthetic peptide directed towards the N terminal of human ACCN2. Synthetic peptide located within the following region: MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF
Asic1 Rabbit Polyclonal Antibody
TA329037

USD 585.00

3 Weeks

Rabbit polyclonal Anti-ASIC1

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide CQKEAKRSSADKGVALSLDD, corresponding to amino acid residues 469-488 of rat ASIC1?. Intracellular, C-terminus.
ACCN2 (ASIC1) Rabbit Polyclonal Antibody
TA350993

USD 345.00

In Stock

Rabbit Polyclonal Anti-ASIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASIC1
Asic1 Rabbit Polyclonal Antibody
TA355727

USD 360.00

5 Days

Accn2 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
ACCN2 (ASIC1) Rabbit Polyclonal Antibody
TA355728

USD 360.00

5 Days

ASIC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human ASIC1