Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ATP5H antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of humanATP5H. |
Rabbit Polyclonal Anti-ATP5H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5H antibody: synthetic peptide directed towards the C terminal of human ATP5H. Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY |
ATP5PD rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATP5PD |