BNC1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BNC1 |
BNC1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BNC1 |
Rabbit Polyclonal Anti-Bnc1 Antibody
Applications | WB |
Reactivities | Mouse |
Immunogen | The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI |
Rabbit Polyclonal BNC1 Antibody
Applications | WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 330-380 of human Bnc 1 protein was used as the immunogen. |
BNC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human BNC1 |