Antibodies

View as table Download

Rabbit Polyclonal Anti-CDADC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDADC1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CDADC1. Synthetic peptide located within the following region: EGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGI

CDADC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

CDADC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein