Germany
Japan
United Kingdom
China
DHTKD1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 395-425 amino acids from the Central region of human DHTKD1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DHTKD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHTKD1 antibody is: synthetic peptide directed towards the N-terminal region of Human DHTKD1. Synthetic peptide located within the following region: YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE |
DHTKD1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DHTKD1 |
DHTKD1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human DHTKD1 (NP_061176.3). |
| Modifications | Unmodified |