Rabbit Polyclonal Anti-ELP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ELP5 Antibody: synthetic peptide directed towards the C terminal of human ELP5. Synthetic peptide located within the following region: FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE |
Rabbit Polyclonal Anti-ELP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ELP5 Antibody: synthetic peptide directed towards the middle region of human ELP5. Synthetic peptide located within the following region: HAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGG |
ELP5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-316 of human ELP5 (NP_056177.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China