Rabbit polyclonal anti-GPR25 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR25. |
Rabbit polyclonal anti-GPR25 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR25. |
Rabbit Polyclonal Anti-GPR25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR25 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR25. Synthetic peptide located within the following region: LIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCRAQAA |
Rabbit Polyclonal Anti-GPR25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR25 Antibody is: synthetic peptide directed towards the middle region of Human GPR25. Synthetic peptide located within the following region: VALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPL |