Antibodies

Jump to Filters
View as table Download
IFNA7 Rabbit Polyclonal Antibody
TA333732

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
IFNA7 Rabbit Polyclonal Antibody
TA360130

USD 360.00

5 Days

IFNA7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human IFNA7