Rabbit Polyclonal Anti-LUC7L Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LUC7L antibody: synthetic peptide directed towards the middle region of human LUC7L. Synthetic peptide located within the following region: EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS |
Rabbit Polyclonal Anti-LUC7L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LUC7L antibody: synthetic peptide directed towards the N terminal of human LUC7L. Synthetic peptide located within the following region: YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS |
LUC7L (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human LUC7L |
LUC7L Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LUC7L |
Germany
Japan
United Kingdom
China
