Rabbit Polyclonal PCDH18 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PCDH12 antibody was raised against a 17 amino acid peptide near the amino terminus of human PCDH12. |
Rabbit Polyclonal PCDH18 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PCDH12 antibody was raised against a 17 amino acid peptide near the amino terminus of human PCDH12. |
Rabbit polyclonal Anti-PCDH18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCDH18 antibody: synthetic peptide directed towards the N terminal of human PCDH18. Synthetic peptide located within the following region: MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED |