Rabbit Polyclonal Antibody against HRD1
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human protein (within residues 300-400). [UniProt Q96PK3] |
Rabbit Polyclonal Antibody against HRD1
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human protein (within residues 300-400). [UniProt Q96PK3] |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit Polyclonal Anti-SYVN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1. Synthetic peptide located within the following region: QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA |
Rabbit Polyclonal Anti-SYVN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV |
Anti-SYVN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human synovial apoptosis inhibitor 1, synoviolin |
SYVN1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SYVN1 (NP_757385.1). |
Modifications | Unmodified |