Antibodies

Jump to Filters
View as table Download
Tmem165 Rabbit Polyclonal Antibody
TA331044

USD 375.00

5 Days

Rabbit polyclonal Anti-Tmem165 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmem165 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tmem165. Synthetic peptide located within the following region: MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPA
TMEM165 Rabbit Polyclonal Antibody
TA382601

USD 220.00

3 Weeks

TMEM165 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2).