Antibodies

Jump to Filters
View as table Download
VPREB1 Rabbit Polyclonal Antibody
TA372056

USD 380.00

4 Weeks

VPREB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human VPREB1
VPREB1 Rabbit Polyclonal Antibody
TA346454

USD 475.00

5 Days

Rabbit Polyclonal Anti-VPREB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPREB1 antibody: synthetic peptide directed towards the middle region of human VPREB1. Synthetic peptide located within the following region: TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP
VPREB1 Rabbit Polyclonal Antibody
TA367815

USD 380.00

4 Weeks

VPREB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human VPREB1
VPREB1 Rabbit Polyclonal Antibody
TA383253

USD 220.00

3 Weeks

VPREB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human VPREB1.