Rabbit polyclonal Anti-YTHDF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YTHDF3 antibody: synthetic peptide directed towards the N terminal of human YTHDF3. Synthetic peptide located within the following region: QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY |
Rabbit polyclonal Anti-YTHDF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YTHDF3 antibody: synthetic peptide directed towards the N terminal of human YTHDF3. Synthetic peptide located within the following region: GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ |
YTHDF3 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human YTHDF3 (NP_689971.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
