Antibodies

Jump to Filters
View as table Download
NSE (ENO2) Rabbit Polyclonal Antibody
TA309202

USD 365.00

In Stock

Rabbit Anti-NSE (Neuron specific enolase) Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant human NSE expressed in and purified from E. coli
RQCD1 (CNOT9) Rabbit Polyclonal Antibody
TA331222

USD 375.00

In Stock

Rabbit Polyclonal Anti-RQCD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK