Antibodies

Jump to Filters
View as table Download
Peroxiredoxin 1 (PRDX1) Rabbit Polyclonal Antibody
TA346666

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRDX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV