Antibodies

Jump to Filters
View as table Download
Phosphoserine phosphatase (PSPH) Rabbit Polyclonal Antibody
TA308185

USD 415.00

2 Weeks

Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330)
Phosphoserine phosphatase (PSPH) Rabbit Polyclonal Antibody
TA342220

USD 375.00

5 Days

Rabbit polyclonal Anti-PSPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
Phosphoserine phosphatase (PSPH) Rabbit Polyclonal Antibody
TA342221

USD 375.00

5 Days

Rabbit polyclonal Anti-PSPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE
Psph Rabbit Polyclonal Antibody
TA363252

USD 360.00

5 Days

PSPH Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse PSPH
Phosphoserine phosphatase (PSPH) Rabbit Polyclonal Antibody
TA380477

USD 220.00

3 Weeks

PSPH Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human PSPH (NP_004568.2).
Modifications Unmodified