Antibodies

Jump to Filters
View as table Download
MDH1 Rabbit Polyclonal Antibody
TA346603

USD 410.00

5 Days

Rabbit Polyclonal Anti-MDH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
MDH1 Rabbit Polyclonal Antibody
TA350161

USD 345.00

In Stock

Rabbit Polyclonal Anti-MDH1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MDH1