Antibodies

Jump to Filters
View as table Download
PTPN22 Rabbit Polyclonal Antibody
TA315315

USD 345.00

In Stock

Rabbit polyclonal anti-PTPN22 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTPN22.
PTPN22 Rabbit Polyclonal Antibody
TA347579

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22
PTPN22 Rabbit Polyclonal Antibody
TA334457

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL
PTPN22 Rabbit Polyclonal Antibody
TA350310

USD 345.00

In Stock

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN22