Antibodies

Jump to Filters
View as table Download
EYA1 Rabbit Polyclonal Antibody
TA346218

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
EYA1 (N-term) Rabbit Polyclonal Antibody
AP51488PU-N

USD 450.00

2 Weeks

EYA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EYA1.
EYA1 Rabbit Polyclonal Antibody
TA355533

USD 390.00

5 Days

EYA1 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EYA1