Antibodies

Jump to Filters
View as table Download
CXCL16 Rabbit Polyclonal Antibody
TA346139

USD 475.00

5 Days

Rabbit Polyclonal Anti-CXCL16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV
CXCL16 Rabbit Polyclonal Antibody
TA328288

USD 285.00

5 Days

Anti-Human CXCL16 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human CXCL16
CXCL16 Rabbit Polyclonal Antibody
TA328287

USD 285.00

5 Days

Biotinylated Anti-Human CXCL16 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human CXCL16