Antibodies

Jump to Filters
View as table Download
RAB8A Rabbit Polyclonal Antibody
TA330007

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB8A Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP